.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of SO2669 protein from Shewanella onedensis Mr-1, a singleton of unknown functions. To be Published
    Site MCSG
    PDB Id 2nr5 Target Id APC83621
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5700,NP_718253, 211586 Molecular Weight 7353.99 Da.
    Residues 64 Isoelectric Point 4.71
    Sequence mmtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwgespia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23066
    Matthews' coefficent 2.25 Rfactor 0.18143
    Waters 365 Solvent Content 45.42

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 6;ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2nr5
    1. NMR structure of biosynthetic engineered human insulin monomer B31Lys_B32Arg in water/acetonitrile solution. Comparison with the solution structure of native
    W Bocian, P Borowicz, J Miko_ajczyk, J Sitkowski - , 2008 - Wiley Online Library
     
    2. Novel recombinant insulin analogue with flexible C-terminus in B chain. NMR structure of biosynthetic engineered A22G-B31K-B32R human insulin monomer in water
    P Borowicz, W Bocian, J Sitkowski, E Bednarek - International Journal of , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch