.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2nr7 Target Id APC85792
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5788,AAQ65511.1, PF05838, 242619 Molecular Weight 21926.83 Da.
    Residues 192 Isoelectric Point 5.80
    Sequence manvklllpyilkweggfvhdpadaggatnkgvtiatwkrvgydkdgdgdidvedlklltdddvlnrvl kpfywdrwkadliesqkvanilvdwvwgsgkygivipqrilgvqadgivgnktlqavnsadpdelfesi fdarrefleditarsikkyedsigrkaterellrhtnkrflrgwlnrledirkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.19665
    Matthews' coefficent 2.09 Rfactor 0.16239
    Waters 410 Solvent Content 41.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nr7
    1. Glycosyltransferases, glycoside hydrolases: surprise, surprise!
    B Henrissat, G Sulzenbacher, Y Bourne - Current opinion in structural , 2008 - Elsevier
     
    2. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
     
    3. CRYO-EM GUIDED DE NOVO PROTEIN FOLDING
    S Lindert - 2011 - etd.library.vanderbilt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch