.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nrk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of conserved protein GrpB from Enterococcus faecalis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2nrk Target Id APC85137
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5761,AAO80728.1, PF04229, 226185 Molecular Weight 20068.12 Da.
    Residues 170 Isoelectric Point 6.61
    Sequence mrvivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekvdllqwe ferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylrenpaiattygtlkkql aqahpdsidkymdgkdafikkiekealkkywe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2134
    Matthews' coefficent 2.25 Rfactor 0.17769
    Waters 289 Solvent Content 45.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nrk
    1. The role of UPF0157 in the folding of M. tuberculosis dephosphocoenzyme A kinase and the regulation of the latter by CTP
    G Walia, P Kumar, A Surolia - PloS one, 2009 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch