.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative SorC family transcriptional regulator from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2o0m Target Id APC85103
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5759,AAO81711.1, PF04198, 226185 Molecular Weight 27830.73 Da.
    Residues 253 Isoelectric Point 7.90
    Sequence nqllgmhqiekemtqyfgiqrcivvagdsdiqkkvlsdfgdvltntlnlllpngentiavmggttmamv aenmgsletekrhnlfvparggigeavsvqansisavmanktggnyralyvpeqlsretynsllqepsi qevltlishancvvhsigralhmaarrkmsddemvmlkqknavaesfgyffdeegkvvykipriglqlk nlqeipyvvaiaggktkakairaymknapkqtwlitdeaaaneilk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20089
    Matthews' coefficent Rfactor 0.164
    Waters 377 Solvent Content

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2o0m
    1. A phospho_sugar binding domain homologous to NagB enzymes regulates the activity of the central glycolytic genes repressor
    T Doan, L Martin, S Zorrilla, D Chaix - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Crystal structures of the effector_binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand_induced structural changes upon
    P _ez_ov, M Koek, SF Moy - Molecular , 2008 - Wiley Online Library
     
    3. Crystal structure of the full-length sorbitol operon regulator SorC from Klebsiella pneumoniae: structural evidence for a novel transcriptional regulation mechanism
    D de Sanctis, CE McVey, FJ Enguita - Journal of molecular , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch