.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o1a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of iron-regulated surface determinant protein A from Staphylococcus aureus - targeted domain 47...188. To be Published
    Site MCSG
    PDB Id 2o1a Target Id APC85836.1
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS5797,BAB57292.1, PF05031, 158878 Molecular Weight 16130.12 Da.
    Residues 142 Isoelectric Point 8.73
    Sequence ateatnatnnqstqvsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwke ykfynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptla daak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20098
    Matthews' coefficent 3.01 Rfactor 0.16699
    Waters 130 Solvent Content 59.13

    Ligand Information
    Ligands SO4 (SULFATE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch