.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o37

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of J-domain of Sis1 protein, Hsp40 co-chaperone from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 2o37 Target Id APC90055.5
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS5967,NP_014391.1, 4932 Molecular Weight 9631.25 Da.
    Residues 89 Isoelectric Point 5.81
    Sequence mvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqkreiydqygl eaarsggpsfgpggpggagg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.1641
    Matthews' coefficent 2.28 Rfactor 0.1395
    Waters 166 Solvent Content 45.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o37
    1. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    2. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     
    3. Central domain deletions affect the SAXS solution structure and function of Yeast Hsp40 proteins Sis1 and Ydj1
    JC Silva, JC Borges, DM Cyr, CHI Ramos - BMC structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch