.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o3f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 2o3f Target Id APC85504
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5776,CAB11945.1, PF01418, 224308 Molecular Weight 11572.78 Da.
    Residues 108 Isoelectric Point 9.17
    Sequence matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlckslglkgfqdlk mrvagdlakptfqgyrdivpheplpsisektagnaiqai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.75 Rfree 0.21452
    Matthews' coefficent 1.98 Rfactor 0.1811
    Waters 137 Solvent Content 37.92

    Ligand Information
    Ligands SO4 (SULFATE) x 15
    Metals

    Jmol

     
    Google Scholar output for 2o3f
    1. Regulation of Glucose Metabolism in Pseudomonas
    A Daddaoua, T Krell, JL Ramos - Journal of Biological Chemistry, 2009 - ASBMB
     
    2. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch