The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved putative domain from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 2o3g Target Id APC85631.1
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5779,AAF41841.1, PF03471, 122586 Molecular Weight 10117.69 Da.
    Residues 89 Isoelectric Point 4.19
    Sequence ereeepavqgnpdesltvegaleyvelapqlnlpqqeedadfhtvaglimeelqtipdvgdfadfhgwr fevvekegqriervkitklp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.26046
    Matthews' coefficent 4.36 Rfactor 0.24174
    Waters 6 Solvent Content 71.80

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch