.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o5h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Uncharacterized Protein Conserved in Bacteria, COG3792 from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2o5h Target Id APC83793
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5714,AAF40945.1, PF04591, 122586 Molecular Weight 15909.04 Da.
    Residues 133 Isoelectric Point 4.56
    Sequence mrklnnhdvhkryqdrleedveftinyelplsclwstikdfssdfeekteaffilfkellrrghlklqr dgqiightpeeweqifrevwpeyeiepnplpgyapfdigmwltveapayavwidpedgseywag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24917
    Matthews' coefficent 2.31 Rfactor 0.20148
    Waters 196 Solvent Content 46.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o5h
    1. Polymorphic toxin systems: comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative
    D Zhang, RF de Souza, V Anantharaman, LM Iyer - Biology , 2012 - biology-direct.com
     
    2. Towards accurate calculations of Zn2+ binding free energies in zinc finger proteins
    T Hok Hei - 2012 - kb.osu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch