.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o6i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an Enterococcus Faecalis HD Domain Phosphohydrolase. To be Published
    Site MCSG
    PDB Id 2o6i Target Id APC28984
    Related PDB Ids 3irh 
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5430,AAO80943, 226185 Molecular Weight 53071.57 Da.
    Residues 456 Isoelectric Point 5.92
    Sequence mtipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgaehsrfshslg vyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpyshtfehifdtnheaitvqiit spetevyqilnrvsadfpekvasvitkqypnpqvvqmissqidadrmdyllrdayftgteygtfdltri lrvirpykggiafamngmhavedyivsryqmyvqvyfhpvsrgmevildhllhrakelfenpefdydlq asllvpffkgdftlqeylklddgvlstyftqwmdvpdsilgdlakrflmrkplksatftnekesaatia ylreliekvgfnpkyytainssydlpydfyrpnkdrhrtqielmqkdgslvelatvsplvaalagqsqg derfyfpkemldqgnkkhydlfdetyrefssyihngalvlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.31715
    Matthews' coefficent 2.84 Rfactor 0.24845
    Waters 302 Solvent Content 56.76

    Ligand Information
    Ligands HED (2-HYDROXYETHYL) x 1
    Metals CL (CHLORIDE) x 2;ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2o6i
    1. The Role of Response Elements Organization in Transcription Factor Selectivity: The IFN-_ Enhanceosome Example
    Y Pan, R Nussinov - PLoS Computational Biology, 2011 - dx.plos.org
     
    2. Characterization of the Deoxynucleotide Triphosphate Triphosphohydrolase (dNTPase) Activity of the EF1143 Protein from Enterococcus faecalis and Crystal
    II Vorontsov, G Minasov, O Kiryukhina - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch