.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Atu2327 from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 2o8i Target Id APC5880
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4895,NP_533000.1, 176299 Molecular Weight 17813.08 Da.
    Residues 165 Isoelectric Point 5.73
    Sequence mvtreefvarfggvfehspfiaeraydaggagleltakavhgalcaqfrvaseaerlgvlrahpdlagk laiageltadsrneqagagldrlspqeharftqlnsaytekfgfpfiiavkglnrhdilsafdtridnn aaqefatatgqvekiawlrlasmlpeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.23723
    Matthews' coefficent Rfactor 0.21069
    Waters 31 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o8i
    1. Structural and Mechanistic Studies on Klebsiella pneumoniae 2-Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline Decarboxylase
    JB French, SE Ealick - Journal of Biological Chemistry, 2010 - ASBMB
     
    2. Comparative structural modeling and docking studies of uricase: Possible implication in enzyme supplementation therapy for hyperuricemic disorders
    SD Beedkar, CN Khobragade, RG Bodade - Computers in Biology , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch