.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o9x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution. Acta Crystallogr.,Sect.D 63 348-354 2007
    Site MCSG
    PDB Id 2o9x Target Id APC5565
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4695,NP_069012, 224325 Molecular Weight 18226.71 Da.
    Residues 159 Isoelectric Point 4.86
    Sequence mrehlklfslifsypdedklgkaialaegiglteiaqtlkqvdiealqveytslfisshpsvpcppyqs yfeegsvygkaslraaelyskyglnyvyeseppdhisveleflsmnpellsdfrdwflefakcveekse iyatfarafrkflekpskvqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.40 Rfree 0.285
    Matthews' coefficent 4.60 Rfactor 0.237
    Waters Solvent Content 74.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o9x
    1. An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution
    O Kirillova, M Chruszcz, IA Shumilin - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Identification of Residues in DmsD for Twin-Arginine Leader Peptide Binding, Defined through Random and Bioinformatics-Directed Mutagenesis
    CS Chan, TML Winstone, L Chang, CM Stevens - Biochemistry, 2008 - ACS Publications
     
    3. Structural analysis of a monomeric form of the twin-arginine leader peptide binding chaperone Escherichia coli DmsD
    CM Stevens, TML Winstone, RJ Turner - Journal of molecular , 2009 - Elsevier
     
    4. Conserved signal peptide recognition systems across the prokaryotic domains.
    SJ Coulthurst, A Dawson, WN Hunter, F Sargent - Biochemistry, 2012 - ACS Publications
     
    5. Structure of the twin-arginine signal-binding protein DmsD from Escherichia coli
    SK Ramasamy, WM Clemons - Acta Crystallographica Section F: , 2009 - scripts.iucr.org
     
    6. Structural Analysis of a Monomeric Form of the Twin-Arginine Leader Peptide Binding Chaperone
    E coli DmsD - J. Mol. Biol, 2009 - sfu.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch