.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oai

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin. TO BE PUBLISHED
    Site MCSG
    PDB Id 2oai Target Id APC86234.2
    Related PDB Ids 2r8d 
    Molecular Characteristics
    Source Xylella fastidiosa temecula1
    Alias Ids TPS5841,AAO28409.1, PF03471, 183190 Molecular Weight 10352.00 Da.
    Residues 91 Isoelectric Point 4.19
    Sequence entdedalmvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgriphvgeyfdwag wrieivdldgaridklllqrln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.19977
    Matthews' coefficent 2.63 Rfactor 0.1746
    Waters 86 Solvent Content 53.25

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2oai
    1. Prediction of ligand binding sites using homologous structures and conservation at CASP8
    MN Wass, MJE Sternberg - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch