.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ob5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Atu2016, putative sugar binding protein. To be Published
    Site MCSG
    PDB Id 2ob5 Target Id APC5878
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4893,NP_532692.1, 176299 Molecular Weight 16157.80 Da.
    Residues 149 Isoelectric Point 5.56
    Sequence mlknidpalnadvlhalramghgdtlvisdtnfpsdsvarqttvgkvlhidnvsaaramkailsvlpld tplqpsvgrmevmgapdqlepvqvevqqeidaaegksapmygierfafyekakqaycvittgetrfygc flltkgvippk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20575
    Matthews' coefficent 2.11 Rfactor 0.17711
    Waters 133 Solvent Content 41.68

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch