.
The Open Protein Structure Annotation Network
PDB Keyword
.

2obb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2obb Target Id APC81396
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5654,AAO75927.1, 226186 Molecular Weight 16560.99 Da.
    Residues 139 Isoelectric Point 5.49
    Sequence mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcrarglefyaan kdypeeerdhqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiysqqreentsqkkkrkwlpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.24475
    Matthews' coefficent 2.47 Rfactor 0.21227
    Waters 83 Solvent Content 50.21

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch