.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ocd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961. To be Published
    Site MCSG
    PDB Id 2ocd Target Id APC26686
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5364,AAF95143, 243277 Molecular Weight 36705.20 Da.
    Residues 337 Isoelectric Point 5.59
    Sequence markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmdssdmtpadwq liaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlrsdgqanllnalhv aanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleaginielstnvkvdekpsgefkvnp itpqpigvitmypgishevirntllqpvnamilltfgvgnapqnpellaqlkaasergvivvnltqcla gkvnmggyatgcaladagvisgydmtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.45 Rfree 0.246
    Matthews' coefficent 2.54 Rfactor 0.176
    Waters 524 Solvent Content 51.53

    Ligand Information
    Ligands ACT (ACETATE) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch