.
The Open Protein Structure Annotation Network
PDB Keyword
.

2och

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of J-domain of dnj-12 from Caenorhabditis elegans. To be Published
    Site MCSG
    PDB Id 2och Target Id APC90013.2
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS5961,O45502, 6239 Molecular Weight 8069.63 Da.
    Residues 70 Isoelectric Point 5.38
    Sequence mvketgyydvlgvkpdasdnelkkayrkmalkfhpdknpdgaeqfkqisqayevlsdekkrqiydqggee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.86 Rfree 0.2472
    Matthews' coefficent 2.50 Rfactor 0.2191
    Waters 51 Solvent Content 50.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2och
    1. Synthesis and biological evaluation of chromium bioorganometallics based on the antibiotic platensimycin lead structure
    M Patra, G Gasser, A Pinto, K Merz, I Ott - , 2009 - Wiley Online Library
     
    2. Synthesis and biological evaluation of pyrazole derivatives containing thiourea skeleton as anticancer agents
    PC Lv, HQ Li, J Sun, Y Zhou, HL Zhu - Bioorganic & medicinal chemistry, 2010 - Elsevier
     
    3. Synthesis, molecular modeling studies, and selective inhibitory activity against monoamine oxidase of N, N_-bis [2-oxo-2 H-benzopyran]-3-
    F Chimenti, D Secci, A Bolasco, P Chimenti - Bioorganic & medicinal , 2006 - Elsevier
     
    4. Synthesis and biological evaluation of N-substituted-3, 5-diphenyl-2-pyrazoline derivatives as cyclooxygenase (COX-2) inhibitors
    R Fioravanti, A Bolasco, F Manna, F Rossi - European journal of , 2010 - Elsevier
     
    5. Virtual screening and synthesis of quinazolines as novel JAK2 inhibitors
    SH Yang, DB Khadka, SH Cho, HK Ju, KY Lee - Bioorganic & Medicinal , 2011 - Elsevier
     
    6. Peroxidase-like activity of Thermobifida fusca hemoglobin: The oxidation of dibenzylbutanolide
    R Torge, A Comandini, B Catacchio - Journal of Molecular , 2009 - Elsevier
     
    7. Homoisoflavonoids: natural scaffolds with potent and selective monoamine oxidase-B inhibition properties
    N Desideri, A Bolasco, R Fioravanti - Journal of Medicinal , 2011 - ACS Publications
     
    8. A convenient synthesis and molecular modeling study of novel purine and pyrimidine derivatives as CDK2/cyclin A3 inhibitors
    ASS Hamad Elgazwy, NSM Ismail - Bioorganic & medicinal , 2010 - Elsevier
     
    9. Synthesis of chromeno [3, 4- b] indoles as Lamellarin D analogues: A novel DYRK1A inhibitor class
    C Neagoie, E Vedrenne, F Buron, JY Mrour - European Journal of , 2012 - Elsevier
     
    10. Chiral 1, 5-disubstituted 1, 3, 5-hexahydrotriazine-2- N-nitroimine analogues as novel potent neonicotinoids: Synthesis, insecticidal evaluation and molecular
    C Sun, J Zhu, H Wang, J Jin, J Xing, D Yang - European journal of , 2011 - Elsevier
     
    11. Potent Clicked MMP2 Inhibitors: Synthesis, Molecular Modeling and Biological Exploration
    JM Zapico, P Serra, J Garca-Sanmartn, K Filipiak - Org. Biomol. , 2011 - xlink.rsc.org
     
    12. Mutants of glycoside hydrolases and uses thereof for synthesizing complex oligosaccharides and disaccharide intermediates
    L Mulard, I Andre, E Champion, C Moulis - EP Patent , 2009 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch