.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ocz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes. TO BE PUBLISHED
    Site MCSG
    PDB Id 2ocz Target Id APC29838
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5480,AAK33746, 160490 Molecular Weight 26099.46 Da.
    Residues 228 Isoelectric Point 4.60
    Sequence mrivapvmprhfdeaqaidiskyedvnliewradflpkdeivavapaifekfagkeiiftlrtvqeggn itlssqeyvdiikeinaiynpdyidfeyfthksvfqemldfpnlilsyhnfeetpenlmeafsemtkla prvvkiavmpqseqdvldlmnytrgfktlnpeqefatismgklgrlsrfagdvigsswtyvsldhvsgp gqvtlndmkriievlemdisn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.23041
    Matthews' coefficent 2.65 Rfactor 0.17492
    Waters 311 Solvent Content 53.57

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2ocz
    1. A Conserved Surface Loop in Type I Dehydroquinate Dehydratases Positions an Active Site Arginine and Functions in Substrate Binding
    SH Light, G Minasov, L Shuvalova, SN Peterson - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch