.
The Open Protein Structure Annotation Network
PDB Keyword
.

2od0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product VP1028 from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2od0 Target Id APC85958
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5800,NP_797407.1, PF04993, 223926 Molecular Weight 22055.06 Da.
    Residues 196 Isoelectric Point 7.87
    Sequence mdkpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqglkpyvykk rgfpvvtkyyaisselwessdrlievakkslenaklekeqqastkpnrlkdlpnlrlatermlkkagid svaqleeegalsaykairdthsttvslellwalegaingthwsvvpqsrreelmngls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.24521
    Matthews' coefficent 2.96 Rfactor 0.19965
    Waters 208 Solvent Content 58.40

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch