.
The Open Protein Structure Annotation Network
PDB Keyword
.

2odf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product Atu2144 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2odf Target Id APC6090
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5001,NP_532818.1, 176299 Molecular Weight 28063.17 Da.
    Residues 257 Isoelectric Point 5.38
    Sequence mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalavarll sekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsalyvpfhdrvseii aerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamlagaegasltvrrndpygpedgvt htlrlhalpdgllnvmieirndlianegeqaaiagflhelmgkalssiee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.90 Rfree 0.23394
    Matthews' coefficent 2.65 Rfactor 0.18891
    Waters 1613 Solvent Content 53.66

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 2odf
    1. Crystal structure of bacteriophage _NIT1 zinc peptidase PghP that hydrolyzes __glutamyl linkage of bacterial poly___glutamate
    Z Fujimoto, K Kimura - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch