.
The Open Protein Structure Annotation Network
PDB Keyword
.

2odk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crsytal structure of putative prevent-host-death protein from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2odk Target Id APC7367
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5126,NP_842121.1, 228410 Molecular Weight 9675.69 Da.
    Residues 85 Isoelectric Point 10.22
    Sequence mhvwpvqdakarfsefldacitegpqivsrrgaeeavlvpigewrrlqaaarpslkqlllsdsarteml vpergkarrrqveplr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.15379
    Matthews' coefficent 1.86 Rfactor 0.13386
    Waters 313 Solvent Content 33.72

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2odk
    1. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch