.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oeq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Protein of Unknown Function from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 2oeq Target Id APC35646
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5497,RBSTP2430, 1422 Molecular Weight 13873.30 Da.
    Residues 119 Isoelectric Point 6.31
    Sequence mseplhalarqleqairasepfqqlkrayedvrrdetayrmfanvrdiqlrlhekqmrgaailpdeieq aqkamalaqqneklarlmaleqqmsitiaevqqiamkpleelhrsfmegr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.90 Rfree 0.31437
    Matthews' coefficent 2.19 Rfactor 0.22222
    Waters 88 Solvent Content 43.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oeq
    1. A score of the ability of a three-dimensional protein model to retrieve its own sequence as a quantitative measure of its quality and appropriateness
    LP Martnez-Castilla, R Rodrguez-Sotres - PloS one, 2010 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch