.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oez

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Protein of Unknown Function VP2528 from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2oez Target Id APC86621.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5861,NP_798907.1, BIG_175.1, 223926 Molecular Weight 28401.08 Da.
    Residues 244 Isoelectric Point 7.17
    Sequence tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkselakdlekqr lsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssirqrfnlpggsccfdlpalh ywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfkaqiaragffqsdadeanilrlhipmky gvypmisghknrfaikfmafengqacsqdvefelavc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.26734
    Matthews' coefficent 3.12 Rfactor 0.21003
    Waters 424 Solvent Content 60.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oez
    1. Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli
    J Durand-Heredia, E Rivkin, G Fan - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch