The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp. To be Published
    Site MCSG
    PDB Id 2ofy Target Id APC6236
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5047,RHA06510, 101510 Molecular Weight 9164.07 Da.
    Residues 86 Isoelectric Point 4.96
    Sequence mvrvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaavarvldl slddvaavvtfgpvsts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.23864
    Matthews' coefficent 2.15 Rfactor 0.20353
    Waters 241 Solvent Content 42.84

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch