.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ogg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the effector-binding domain of the trehalose repressor TreR from Bacillus subtilis 168 reveals a unique quarternary assembly. Proteins 69 679-682 2007
    Site MCSG
    PDB Id 2ogg Target Id APC85412
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5768,CAB12611.1, PF07702, 224308 Molecular Weight 17695.13 Da.
    Residues 149 Isoelectric Point 5.54
    Sequence tlgketkttvhkfgleppseliqkqlranldddiwevirsrkidgehvildkdyffrkhvphltkeice nsiyeyiegelglsisyaqkeivaepctdedrelldlrgydhmvvvrnyvfledtslfqytesrhrldk frfvdfarrgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.24659
    Matthews' coefficent 3.98 Rfactor 0.19024
    Waters 36 Solvent Content 69.11

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 3
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2ogg
    1. Insight into the induction mechanism of the GntR/HutC bacterial transcription regulator YvoA
    M Resch, E Schiltz, F Titgemeyer - Nucleic acids , 2010 - Oxford Univ Press
     
    2. The crystal structure of the effector_binding domain of the trehalose repressor TreR from Bacillus subtilis 168 reveals a unique quarternary assembly
    P _ez_ov, V Krej_i_kov, D Borek - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch