.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a predicted thioesterase from Bacillus stearothermophilus. TO BE PUBLISHED
    Site MCSG
    PDB Id 2oiw Target Id APC36038
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5532,RBSTP2694, 1422 Molecular Weight 15481.89 Da.
    Residues 133 Isoelectric Point 5.79
    Sequence mfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevdyvnqmyygqdv tvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipddirvklrehvwqpge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.2326
    Matthews' coefficent 2.11 Rfactor 0.17561
    Waters 447 Solvent Content 41.81

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2oiw
    1. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    2. Function-Biased Choice of Additives for Optimization of Protein Crystallization: The Case of the Putative Thioesterase PA5185 from Pseudomonas aeruginosa PAO1
    M Chruszcz, MD Zimmerman, S Wang - Crystal Growth and , 2008 - ACS Publications
     
    3. Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion
    T Hosaka, K Murayama, M Kato-Murayama - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch