.
The Open Protein Structure Annotation Network
PDB Keyword
.

2okq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown conserved ybaA protein from Shigella flexneri. TO BE PUBLISHED
    Site MCSG
    PDB Id 2okq Target Id APC27291
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5383,AAP15934, 198215 Molecular Weight 13317.56 Da.
    Residues 117 Isoelectric Point 4.80
    Sequence mkyvdgfvvavpadkkdayremaakaaplfkefgalrivecwasdvpdgkvtdfrmavkaeeneevvfs wieypskevrdaanqkmmsdprmkefgesmpfdgkrmiyggfesiide
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.22635
    Matthews' coefficent 2.04 Rfactor 0.1828
    Waters 176 Solvent Content 39.72

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2okq
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch