.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2oku Target Id APC90333.2
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5972,AAQ65936.1, 242619 Molecular Weight 14931.06 Da.
    Residues 128 Isoelectric Point 5.29
    Sequence aairhittgtyiarireeyqqtevkpelqpmkealarmtdraealiafvteqkdqelldfqarrlvemt ahavfghllmlaandddsfrqsaevylrygqaeqekidsyvrafrpeeltfysrcsrpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.20541
    Matthews' coefficent 3.37 Rfactor 0.17345
    Waters 352 Solvent Content 63.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch