.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ols

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the phosphoenolpyruvate synthase from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2ols Target Id APC84135
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5732,AAF41044.1, 122586 Molecular Weight 87165.33 Da.
    Residues 794 Isoelectric Point 5.01
    Sequence madnyviwfenlrmtdvervggknaslgemisqltekgvrvpggfattaeayraflahnglserisaal akldvedvaelarvgkeirqwildtpfpeqldaeieaawnkmvadaggadisvavrssataedlpdasf agqqetflningldnvkeamhhvfaslyndraisyrvhkgfehdivalsagvqrmvrsdsgasgvmftl dtesgydqvvfvtssyglgenvvqgavnpdefyvfkptlkagkpailrktmgskhikmiftdkaeagks vtnvdvpeedrnrfsitdeeitelahyaltiekhygrpmdiewgrdgldgklyilqarpetvksqeegn rnlrrfaingdktvlcegraigqkvgqgkvrlikdasemdsveagdvlvtdmtdpdwepvmkrasaivt nrggrtchaaiiarelgipavvgcgnatellkngqevtvscaegdtgfiyaglldvqitdvaldnmpka pvkvmmnvgnpelafsfanlpsegiglarmefiinrqigihpkallefdkqddelkaeitrriagyasp vdfyvdkiaegvatlaasvyprktivrmsdfksneyanlvggnvyepheenpmlgfrgaaryvadnfkd cfaleckalkrvrdemgltnveimipfvrtlgeaeavvkalkenglergknglrlimmcelpsnavlae qflqyfdgfsigsndmtqltlgldrdsglvsesfdernpavkvmlhlaisacrkqnkyvgicgqgpsdh pdfakwlveegiesvslnpdtvietwlylanelnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.25087
    Matthews' coefficent 3.47 Rfactor 0.19796
    Waters 410 Solvent Content 64.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ols
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Survey of large protein complexes in D. vulgaris reveals great structural diversity
    BG Han, M Dong, H Liu, L Camp - Proceedings of the , 2009 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch