.
The Open Protein Structure Annotation Network
PDB Keyword
.

2omk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Bacteroides Thetaiotaomicron Thiamin Pyrophosphokinase. To be Published
    Site MCSG
    PDB Id 2omk Target Id APC81767
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5674,AAO77504.1, 226186 Molecular Weight 23014.80 Da.
    Residues 207 Isoelectric Point 4.96
    Sequence minehyipqavilangeypahelplrllaeaqfvvccdgaaneyisrghtpdviigdgdsllpeykkrf ssiilqisdqetndqtkavhylqskgirkiaivgatgkredhtlgnisllveymrsgmevrtvtdygtf ipvsdtqsfasypgqqvsiinfgakglkaeglfyplsdftnwwqgtlneaiadeftihctgeylvflay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.20025
    Matthews' coefficent 2.05 Rfactor 0.16454
    Waters 504 Solvent Content 39.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2omk
    1. Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathwayevidence of a different substrate specificity
    N Barison, L Cendron, A Trento, A Angelini - FEBS , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch