.
The Open Protein Structure Annotation Network
PDB Keyword
.

2omo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of putative antibiotic biosynthesis monooxygenase from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2omo Target Id APC6266
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5055,NP_840705.1, 228410 Molecular Weight 11552.37 Da.
    Residues 100 Isoelectric Point 5.89
    Sequence myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrkdaaahketa hyltwrdtvadwmaeprkgviygglyptgdd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.83 Rfree 0.2277
    Matthews' coefficent 2.06 Rfactor 0.1895
    Waters 610 Solvent Content 40.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2omo
    1. A discrete view on fold space
    MJ Sippl, SJ Suhrer, M Gruber, M Wiederstein - Bioinformatics, 2008 - Oxford Univ Press
     
    2. STRUCTURALLY-RELATED RELAXIN-FUSION PROTEINS WITH EXTENDED IN VIVO HALF-LIVES
    T Wang - US Patent App. 13/079,596, 2011 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch