.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ooi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product SA0254 from Staphylocococcus aureus subsp. aureus N315. To be Published
    Site MCSG
    PDB Id 2ooi Target Id APC23081
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5252,NP_373500, PF07702, 158879 Molecular Weight 27057.48 Da.
    Residues 234 Isoelectric Point 7.73
    Sequence mlkyehiakqlnafihqsnfkpgdklpnvtqlkeryqvskstiikalglleqdgliyqaqgsgiyvrni adanrinvfktngfskslgehrmtskvlvfkematppksvqdelqlnaddtvyylerlrfvdddvlcie ysyyhkeivkylnddiakgsifdylesnmklrigfsdiffnvdkltsseasllqlstgepclryhqtfy tmtgkpfdssdivfhyrhaqfyipskk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.27002
    Matthews' coefficent 4.42 Rfactor 0.22361
    Waters 49 Solvent Content 72.14

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2ooi
    1. Insight into the induction mechanism of the GntR/HutC bacterial transcription regulator YvoA
    M Resch, E Schiltz, F Titgemeyer - Nucleic acids , 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch