.
The Open Protein Structure Annotation Network
PDB Keyword
.

2op6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of peptide-binding domain of Heat shock 70 kDa protein D precursor from C.elegans. To be Published
    Site MCSG
    PDB Id 2op6 Target Id APC90014.13
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS5962,P20163, 6239 Molecular Weight 16254.40 Da.
    Residues 149 Isoelectric Point 4.88
    Sequence dvnpltlgietvggvmtkligrntviptkksqvfstaadsqsavsiviyegerpmvmdnhklgnfdvtg ippaprgvpqievtfeidvngilhvsaedkgtgnknkltitndhnrlspediermindadkfaaddqaq kekvesrnele
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2124
    Matthews' coefficent 2.37 Rfactor 0.1689
    Waters 167 Solvent Content 48.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2op6
    1. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    2. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     
    3. Sphericity of a protein via the-complex
    DS Kim, JK Kim, CI Won, CM Kim, JY Park - Journal of Molecular , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch