.
The Open Protein Structure Annotation Network
PDB Keyword
.

2opi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-fuculose-1-phosphate aldolase from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2opi Target Id APC81501
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5657,AAO76381.1, 226186 Molecular Weight 23374.59 Da.
    Residues 212 Isoelectric Point 5.65
    Sequence mitdehielflaqahrygdaklmlcssgnlswrigeealisgtgswvptlakekvsicniasgtptngv kpsmestfhlgvlrerpdvnvvlhfqseyataiscmknkptnfnvtaeipchvgseipvipyyrpgspe lakavveamlkhnsvlltnhgqvvcgkdfdqvyeratffemacriivqsggdysvltpeeiedleiyvl gkktk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.25955
    Matthews' coefficent 3.02 Rfactor 0.22499
    Waters 40 Solvent Content 59.24

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch