.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oqg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the ArsR-like Transcriptional Regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2oqg Target Id APC5909
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4920,RHA06426, 101510 Molecular Weight 12100.10 Da.
    Residues 110 Isoelectric Point 6.61
    Sequence mtvgtyaelasvfaalsdetrweiltelgradqsasslatrlpvsrqaiakhlnalqacglvesvkvgr eiryralgaelnktartlerigaewdrrlaaikqiaesmee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.54 Rfree 0.256
    Matthews' coefficent 1.95 Rfactor 0.188
    Waters 575 Solvent Content 36.91

    Ligand Information
    Ligands ACY (ACETIC) x 4
    Metals

    Jmol

     
    Google Scholar output for 2oqg
    1. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch