.
The Open Protein Structure Annotation Network
PDB Keyword
.

2or0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative hydroxylase from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2or0 Target Id APC7385
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5129,RHA04100, 101510 Molecular Weight 42054.42 Da.
    Residues 391 Isoelectric Point 5.27
    Sequence mgrvldrievvaeeirgqavqseadcrltdaaagllrdsgairllqprlyggyevhprefaetvmgvaa ldgasgwvtgivgvhpwelafadpqvqeeiwgedndtwmaspyapmgvatpvdggyvlkgrwsfssgtd hcqwaflgamvgdgeggiatpsslhvilprtdyqivedtwdviglrgtgskdlivdgafvpgyrtlnaa kvmdgraqkeagrpeplfnmpyscmfplgitaavigitegalachiavqkdrvaitgqkikedpyvlsa igesaaeinasrvslietadrfydkvdagkeitfeeraigrrtqiaaawravraadeifaragggalhy ktpmqrfwrdahaglahavhvpgptnhasaltqlggepqgmmrami
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.21764
    Matthews' coefficent 3.24 Rfactor 0.18382
    Waters 559 Solvent Content 62.05

    Ligand Information
    Ligands ACT (ACETATE) x 12
    Metals

    Jmol

     
    Google Scholar output for 2or0
    1. Identification of functionally important amino acids in a novel indigo-producing oxygenase from Rhodococcus sp. strain T104
    NR Kwon, JC Chae, KY Choi, M Yoo, GJ Zylstra - Applied microbiology , 2008 - Springer
     
    2. Structure and mechanism of ORF36, an Aminosugar Oxidizing Enzyme in Everninomicin Biosynthesis
    JL Vey, A Al-Mestarihi, Y Hu, MA Funk - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch