.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ot9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of YaeQ protein from Pseudomonas syringae. To be Published
    Site MCSG
    PDB Id 2ot9 Target Id APC84959
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5751,AAO55008.1, PF07152, 223283 Molecular Weight 20732.49 Da.
    Residues 180 Isoelectric Point 5.16
    Sequence maqpsttykfelnltdldrgvyesvkqtiarhpseteermtvrllayafwyneqlafgrglsdvdepal wekslddrvlhwievgqpdadrltwcsrrtertsllaygslrvwegkvipaiknlknvniaavpqdvle vlakdmprvikwdvmisegtvfvtddrgqhevqlqwltgerg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.97 Rfree 0.23911
    Matthews' coefficent 2.32 Rfactor 0.1776
    Waters 111 Solvent Content 46.94

    Ligand Information
    Ligands SRT (S,R) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch