The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the glycerophosphodiester phosphodiesterase from Shigella flexneri 2a. To be Published
    Site MCSG
    PDB Id 2otd Target Id APC28280
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5403,AAP19255, 198215 Molecular Weight 27312.92 Da.
    Residues 247 Isoelectric Point 5.98
    Sequence msnwpyprivahrgggklapentlaaidvgakyghkmiefdaklskdgeifllhddnlertsngwgvag elnwqdllrvdagswyskafkgeplpllsqvaercrehgmmanieikpttgtgpltgkmvalaarqlwa gmtppllssfeidaleaaqqaapelprgllldewrddwreltarlgcvsihlnhklldkarvmqlkdag lrilvytvnkpqhaaellrwgvdcictdaidvigpnftaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.27567
    Matthews' coefficent 3.34 Rfactor 0.22095
    Waters 132 Solvent Content 63.15

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch