.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ouf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site MCSG
    PDB Id 2ouf Target Id APC5925
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4934,NP_207040.1, 85962 Molecular Weight 11086.05 Da.
    Residues 94 Isoelectric Point 4.73
    Sequence mrdyseleifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesfakalridee lqqkiesrktdiviqsmanilsgne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.263
    Matthews' coefficent 2.68 Rfactor 0.232
    Waters 50 Solvent Content 54.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ouf
    1. A novel dimerization motif in the C-terminal domain of the Thermus thermophilus DEAD box helicase Hera confers substantial flexibility
    D Klostermeier, MG Rudolph - Nucleic acids research, 2009 - Oxford Univ Press
     
    2. Structure and folding of a designed knotted protein
    NP King, AW Jacobitz, MR Sawaya - Proceedings of the , 2010 - National Acad Sciences
     
    3. Structures and folding pathways of topologically knotted proteins
    P Virnau, A Mallam, S Jackson - Journal of Physics: Condensed , 2011 - iopscience.iop.org
     
    4. Motif prediction in amino acid interaction networks
    O Gaci, S Balev - 2009 - hal.archives-ouvertes.fr
     
    5. Reconstructing amino acid interaction networks by an ant colony approach
    O Gaci, S Balev - Journal of Computational Intelligence , 2009 - hal.archives-ouvertes.fr
     
    6. How to Fold Amino Acid Interaction Networks by Computational Intelligence Methods
    O Gaci - BioInformatics and BioEngineering (BIBE), 2010 IEEE , 2010 - ieeexplore.ieee.org
     
    7. Ant colony approach to predict amino acid interaction networks
    O Gaci, S Balev - , 2009. NaBIC 2009. World Congress on, 2009 - ieeexplore.ieee.org
     
    8. Energy landscape of knotted protein folding
    JI Su_kowska, JK Noel - Proceedings of the , 2012 - National Acad Sciences
     
    9. A Study of the Protein Folding Problem by a Simulation Model
    O Gaci - Machine Learning and Systems Engineering, 2010 - Springer
     
    10. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     
    11. A Study of the Protein Folding Dynamic
    O Gaci - IAENG International Journal of Computer Science, 2010 - hal.archives-ouvertes.fr
     
    12. A dynamic graph to fold amino acid interaction networks
    O Gaci - Computation (CEC), 2010 IEEE Congress on, 2010 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch