.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ov9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein RHA08564, thioesterase superfamily protein. To be Published
    Site MCSG
    PDB Id 2ov9 Target Id APC7304
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5111,RHA08564, 101510 Molecular Weight 22665.27 Da.
    Residues 216 Isoelectric Point 5.73
    Sequence vsvgthptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghleeha pavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgppghvhggvsalll dhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrkittagdirtadgqvcvsveglf vdktvprpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23632
    Matthews' coefficent 2.18 Rfactor 0.19395
    Waters 401 Solvent Content 43.57

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2ov9
    1. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    2. Acyl Coenzyme A Thioesterase Them5/Acot15 Is Involved in Cardiolipin Remodeling and Fatty Liver Development
    E Zhuravleva, H Gut, D Hynx, D Marcellin - and Cellular Biology, 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch