.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein VPA0057 from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2oyz Target Id APC86608.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5860,NP_799567.1, BIG_171.1, 223926 Molecular Weight 10080.71 Da.
    Residues 93 Isoelectric Point 4.64
    Sequence sikensyfaggvkslgfnqhgqdvsvgvmlpgeytfgtqapermtvvkgalvvkrvgeadwttyssges fdvegnssfelqvkdataylceyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.71 Rfree 0.23657
    Matthews' coefficent 2.30 Rfactor 0.20298
    Waters 104 Solvent Content 46.49

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch