.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p06

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304. To be Published
    Site MCSG
    PDB Id 2p06 Target Id APC7408
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5132,AAB91172.1, 224325 Molecular Weight 11459.47 Da.
    Residues 93 Isoelectric Point 4.96
    Sequence mdyfrlaekflremhakymkrvsrpgntprpwfdfseerllsrlfeemdelreavekedwenlrdelld vanfcmylwgklsvkniydkgeeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.18655
    Matthews' coefficent 3.49 Rfactor 0.16919
    Waters 124 Solvent Content 64.79

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2p06
    1. Data growth and its impact on the SCOP database: new developments
    A Andreeva, D Howorth, JM Chandonia - Nucleic acids , 2008 - Oxford Univ Press
     
    2. Structural diversity of class I MHC-like molecules and its implications in binding specificities.
    MDI HASSAN, F AHMAD - Advances in protein chemistry and , 2011 - books.google.com
     
    3. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch