.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative ABC transporter domain from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2p0s Target Id APC90123.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5969,AAQ66075.1, 242619 Molecular Weight 15686.60 Da.
    Residues 140 Isoelectric Point 4.87
    Sequence qlggdmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledpnavai ygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwsedgtnertsgelasg is
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.22475
    Matthews' coefficent 1.89 Rfactor 0.1769
    Waters 185 Solvent Content 34.99

    Ligand Information
    Ligands ACT (ACETATE) x 1;FMT (FORMIC) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2p0s
    1. Building an understanding of cystic fibrosis on the foundation of ABC transporter structures
    JL Mendoza, PJ Thomas - Journal of bioenergetics and biomembranes, 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch