The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 2p0t Target Id APC85033
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5754,AAO57913.1, PF04751, 223283 Molecular Weight 19653.32 Da.
    Residues 169 Isoelectric Point 6.98
    Sequence mvdsyddsldgeksktqvkrelhalvdlgerlttlkadvlaklpltdalrkalaeapkhtaniarkrhi lfigklmrdqdqeailvlldqldastrqynerfhnlerwrdrliagddadlekfvieypdadrqqlrsl irqaqhevarnkppatsrkifkyireldelq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.19 Rfree 0.28484
    Matthews' coefficent 2.06 Rfactor 0.21609
    Waters 18 Solvent Content 40.17

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch