.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein of uncharacterized function, DUF402 from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2p12 Target Id APC7392
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5130,RHA02527, 101510 Molecular Weight 19794.94 Da.
    Residues 172 Isoelectric Point 5.25
    Sequence magashdihppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlglra sifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeahttglldtatae qailtattaidgiaahghdlgrwlasigmpidwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.63 Rfree 0.216
    Matthews' coefficent 2.13 Rfactor 0.171
    Waters 528 Solvent Content 42.30

    Ligand Information
    Ligands ACY (ACETIC) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2p12
    1. Cellular protein modification by poliovirus: the two faces of poly (rC)-binding protein
    R Perera, S Daijogo, BL Walter, JHC Nguyen - Journal of , 2007 - Am Soc Microbiol
     
    2. Heterogeneous nuclear ribonucleoproteins (hnRNPs) in cellular processes: Focus on hnRNP E1's multifunctional regulatory roles
    A Chaudhury, P Chander, PH Howe - RNA, 2010 - rnajournal.cshlp.org
     
    3. The first founder DGUOK mutation associated with hepatocerebral mitochondrial DNA depletion syndrome
    N Brahimi, M Jambou, E Sarzi, V Serre - Molecular genetics and , 2009 - Elsevier
     
    4. Role of Leucine-Rich Repeat Proteins in the Development and Function of Neural Circuits
    J De Wit, W Hong, L Luo, A Ghosh - Annual review of cell and , 2011 - annualreviews.org
     
    5. Neurexins, Neuroligins and LRRTMs: synaptic adhesion getting fishy
    GJ Wright, P Washbourne - Journal of neurochemistry, 2011 - Wiley Online Library
     
    6. ATM gene alterations in chronic lymphocytic leukemia patients induce a distinct gene expression profile and predict disease progression
    A Guarini, M Marinelli, S Tavolaro, E Bellacchio - , 2011 - haematologica.com
     
    7. 1 H, 13 C, and 15 N resonance assignments for human regenerating family I_ protein
    MR Ho, C Chen - Biomolecular NMR Assignments, 2011 - Springer
     
    8. Functional Genomics-and Network-driven Systems Biology Approaches for Pharmacogenomics and Toxicogenomics
    X Yang, B Zhang, J Zhu - Current Drug Metabolism, 2012 - ingentaconnect.com
     
    9. Clonacin y caracterizacin de genes efectores de especies patognicas del gnero Phytophthora que atacan cultivos de la familia solanaceae en los Andes del
    VD Armijos Jaramillo - 2007 - repositorio.espe.edu.ec
     
    10. Identifikation von Interaktionspartnern des humanen DNA-Reparaturproteins MLH1 mit einem bakteriellen Zweihybrid-System
    FN Wolpert - 2011 - deposit.ddb.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch