.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the transporter associated domain CorC_HlyC from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2p13 Target Id APC86385.3
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5849,CAD86139.1, PF03471, 228410 Molecular Weight 9854.64 Da.
    Residues 87 Isoelectric Point 5.00
    Sequence eekvvaeqqadgtwlmdgwisirkasnllehdlvdeaerystlggyllwqfgyipaageqitvdglife ivsvnkhnigkvrvhrtq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.243
    Matthews' coefficent 2.20 Rfactor 0.199
    Waters 179 Solvent Content 44.02

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2p13
    1. BMP-7 as antagonist of organ fibrosis
    R Weiskirchen, SK Meurer, OA Gressner, J Herrmann - Front Biosci, 2009 - josorge.com
     
    2. Kinetic properties of mutant deoxyguanosine kinase in a case of reversible hepatic mtDNA depletion
    JW Taanman, S Padet, M Chassagne - Biochemical , 2007 - ncbi.nlm.nih.gov
     
    3. Identification of the phosphorylation sites on the E3 ubiquitin ligase Pellino that are critical for activation by IRAK1 and IRAK4
    H Smith, M Peggie, DG Campbell - Proceedings of the , 2009 - National Acad Sciences
     
    4. The first founder DGUOK mutation associated with hepatocerebral mitochondrial DNA depletion syndrome
    N Brahimi, M Jambou, E Sarzi, V Serre - Molecular genetics and , 2009 - Elsevier
     
    5. Transcription of HERV-E and HERV-E-related sequences in malignant and non-malignant human haematopoietic cells
    BK Prusty, H zur Hausen, R Schmidt, R Kimmel - Virology, 2008 - Elsevier
     
    6. Modelling the structure of the red cell membrane
    NM Burton, LJ Bruce - Biochemistry and Cell Biology, 2011 - ingentaconnect.com
     
    7. Crystal structure of the C_terminal conserved domain of human GRP, a galectin_related protein, reveals a function mode different from those of galectins
    D Zhou, H Ge, J Sun, Y Gao, M Teng - : Structure, Function, and , 2008 - Wiley Online Library
     
    8. Ferlins: Regulators of Vesicle Fusion for Auditory Neurotransmission, Receptor Trafficking and Membrane Repair
    A Lek, FJ Evesson, RB Sutton, KN North, ST Cooper - Traffic, 2011 - Wiley Online Library
     
    9. Sequence and transcriptional study of HNRPK pseudogenes, and expression and molecular modeling analysis of hnRNP K isoforms
    F Carregaro, CHTP Silva, O Feitosa, UM Mancini - , 2007 - ingentaconnect.com
     
    10. Molecular genetic studies of gene identification for osteoporosis
    Y Guo, TL Yang, F Pan, XH Xu - Expert Review of , 2008 - ingentaconnect.com
     
    11. INAUGURAL ARTICLE by a Recently Elected Academy Member: Identification of the phosphorylation sites on the E3 ubiquitin ligase Pellino that are critical
    H Smith, M Peggie, DG Campbell - Proceedings of the , 2009 - ncbi.nlm.nih.gov
     
    12. Study on herb-drug interactions
    L Yang - 2009 - researchbank.rmit.edu.au
     
    13. Human Metabolome Database Version 2.5
    S Class, S Class - Enzyme, 2008 - hmdb.ca
     
    14. Introduction to Bioinformatics
    SM Thampi - Arxiv preprint arXiv:0911.4230, 2009 - arxiv.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch