.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p19

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Bacterial regulatory protein of gntR family from Corynebacterium glutamicum. To be Published
    Site MCSG
    PDB Id 2p19 Target Id APC86088
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS5822,CAF18724.1, PF07702, 196627 Molecular Weight 27875.30 Da.
    Residues 253 Isoelectric Point 5.70
    Sequence mtteapiwpaelfedldrngpiplyfqvaqrledgirsgvlppgarleneisvakhlnvsrptvrraiq evvdkgllvrrrgvgtqvvqshvtrpveltsffndlknanldpktrvlehrllaassaiaeklgvsagd evllirrlrstgdipvailenylppafndvsldelekgglydalrsrgvvlkianqkigarravgeest lldiedggplltvervaldnsgqvielgshcyrpdmynfettlvar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.21874
    Matthews' coefficent 3.79 Rfactor 0.17789
    Waters 506 Solvent Content 67.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p19
    1. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    2. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch