.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p1z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoribosyltransferase from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2p1z Target Id APC82894
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5693,CAE50625.1, 1717 Molecular Weight 18857.60 Da.
    Residues 177 Isoelectric Point 5.97
    Sequence mskkaelaelvkelavvhgkvtlssgkeadyyvdlrratlharasrligellreltadwdyvavggltl gadpvatsvmhadgreihafvvrkeakkhgmqrriegpdvvgkkvlvvedttttgnspltavkalreag aevvgvatvvdratgaadviaaegleyryilgledlgla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.44 Rfree 0.30847
    Matthews' coefficent 1.92 Rfactor 0.22577
    Waters 103 Solvent Content 35.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p1z
    1. The Leishmania donovani UMP synthase is essential for promastigote viability and has an unusual tetrameric structure that exhibits substrate-controlled
    JB French, PA Yates, DR Soysa, JM Boitz - Journal of Biological , 2011 - ASBMB
     
    2. Structure of orotate phosphoribosyltransferase from the caries pathogen Streptococcus mutans
    CP Liu, R Xu, ZQ Gao, JH Xu, HF Hou, LQ Li - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch