.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of trans-aconitate methyltransferase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2p35 Target Id APC6108
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5010,NP_531568.1, 176299 Molecular Weight 28435.70 Da.
    Residues 256 Isoelectric Point 5.41
    Sequence mawsaqqylkfedertrpardllaqvplervlngydlgcgpgnstelltdrygvnvitgidsdddmlek aadrlpntnfgkadlatwkpaqkadllyanavfqwvpdhlavlsqlmdqlesggvlavqmpdnlqepth iamhetadggpwkdafsggglrrkplpppsdyfnalspkssrvdvwhtvynhpmkdadsivewvkgtgl rpylaaageenreafladytrriaaayppmadgrlllrfprlfvvavkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.21435
    Matthews' coefficent 2.83 Rfactor 0.18564
    Waters 403 Solvent Content 56.52

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2p35
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch