.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p3p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a domain of an uncharacterized protein PG_1388 from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2p3p Target Id APC90158.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5970,AAQ66449.1, 242619 Molecular Weight 23318.25 Da.
    Residues 204 Isoelectric Point 5.27
    Sequence sqeivagelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnfiriqt stvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpriedfflphtdrqsy ayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaiflspeplvyrwqsgrfvrqvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.22645
    Matthews' coefficent 2.20 Rfactor 0.16547
    Waters 556 Solvent Content 43.99

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2p3p
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch